PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005630-PA
Common NameOsI_08918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 232aa    MW: 27394.9 Da    PI: 5.638
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005630-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.41.1e-26113163252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++++e +s+yF lpik+AA+eL+v+lT+LKr+CR +GI+RWPhRk+ksl
  BGIOSGA005630-PA 113 EKTLTFELVSQYFCLPIKQAAQELNVGLTLLKRRCRVLGIPRWPHRKVKSL 163
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.40595184IPR003035RWP-RK domain
PfamPF020423.8E-22115163IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEKWRFYGGH QFQSYSFHEE ENLFQDWSLD YLLLGEDEPF FTHHFSTSVH SNFVQDELYT  60
LFDGDILSIW GDMKEDAYHR SDKDGGEKEE KLDHEKAMEL QLQRLPSGRQ SGEKTLTFEL  120
VSQYFCLPIK QAAQELNVGL TLLKRRCRVL GIPRWPHRKV KSLETLIKNV QELGMETGQD  180
EDNTRNAVEM LQQTKKLIEQ SPDAKLDDWT KMLRQACFKE NYKRRRLLAI EG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222226KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627113.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627114.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627115.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627116.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627117.11e-174PREDICTED: protein RKD1-like
SwissprotQ9M9U96e-42RKD1_ARATH; Protein RKD1
TrEMBLA0A0D9YY631e-174A0A0D9YY63_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HLA41e-174A0A0E0HLA4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NKW91e-174A0A0E0NKW9_ORYRU; Uncharacterized protein
TrEMBLA2X9K21e-174A2X9K2_ORYSI; Putative uncharacterized protein
TrEMBLI1P4801e-174I1P480_ORYGL; Uncharacterized protein
STRINGBGIOSGA005630-PA1e-173(Oryza sativa Indica Group)
STRINGORGLA02G0278600.11e-173(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-43RWP-RK domain-containing protein